Products

Recombinant Mouse Beta-defensin 14(Defb14)

Size

100 μg

Catalog no.

RPC20159

Price

463 EUR

Gene number

Defb14

Protein origin

E.coli

Use before

1 year

Protein number

Q7TNV9

Protein region

23-67aa

Protein purity

≥ 90%

Expected molecular weight

21.2kDa

Shipping requirements

Blue ice

Information about sequence

Full Length

Group

recombinants

Latin name

Mus musculus

Other name

Defensin, beta 14

Estimated production time

7-11 business days

Verified reactivity

Mus musculus (Mouse)

Source

Recombinants or rec. proteins

Protein sequence

FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Description

human, mouse or other beta β- and alpha α- defensins are expressed by neutrophils ( α- ), lymphocytes and epithelial cells. DEFA DEFB genes defend the host against pathogens. GENTAUR supplies anti-defensins, monclonals, polyclonals antisera and recombinant DEFs or peptides of defensin.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.